PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG030200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRF
Protein Properties Length: 458aa    MW: 49143.7 Da    PI: 9.7386
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG030200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.82.1e-24203247145
                  WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                          d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Pavir.4NG030200.1.p 203 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 247
                          79****************************************986 PP

2QLQ61.42.5e-21129163236
                  QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                           FTaaQ+++L++Q+l+yKyL+a++PvPp+Ll++++
  Pavir.4NG030200.1.p 129 VFTAAQWAELEQQALIYKYLMAGVPVPPDLLLPVR 163
                          5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.5E-11128164IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.07129164IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-15130163IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.346203247IPR014977WRC domain
PfamPF088795.8E-21204246IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MEVVQWEGVG KEKRCEYPRL PREGQQGGRA GPGPGPGPRG STRRQATRQA ASQRVRLEAG  60
AIASKANPSG LPPSYLQIPP PTPKGRVGVE PTGGGQAIDA ELGILGGGGD WGGGRGGGGY  120
PPPQRGAAVF TAAQWAELEQ QALIYKYLMA GVPVPPDLLL PVRPSPHSAA AFSFTNPGAA  180
ASPFYHHHHP SLSYYAYYGK KLDPEPWRCR RTDGKKWRCS KEAHPDSKYC ERHMHRGRNR  240
SRKPVESKTA SPAHPSQPQL STVTTTTRER APLDSLTVGG KTHGLSLGGA GSSQLHVDAS  300
NAHYRYGSKY PLGAKADAGE LSFFSGASGN SRGFTIDSPT ENSWNSLPSN VPPFTLSKSR  360
DSGLLPGTYS YSQLEPPQEL GQVTIASLSQ EQERHSFSSG AGGLLGNVKQ ENQPLRPFFD  420
EWPGTRDSWS EMDDARPNRT SFSTTQLSIS IPMPRCD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1112118GGRGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.89740.0callus| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964364.10.0PREDICTED: growth-regulating factor 5-like isoform X1
SwissprotQ6AWY40.0GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLK3Y3N10.0K3Y3N1_SETIT; Uncharacterized protein
STRINGSi008818m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110462431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-22growth-regulating factor 5